PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g043493m
Common NameCISIN_1g043493mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 255aa    MW: 26709.6 Da    PI: 7.6392
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g043493mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.3e-382684361
             zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       +++l+cprC+st tkfCyynny+lsqPr+fCk+CrryWt+GG+lrn+PvGgg+rkn k+
  orange1.1g043493m 26 TESLPCPRCESTSTKFCYYNNYNLSQPRHFCKSCRRYWTQGGTLRNIPVGGGTRKNSKR 84
                       67899***************************************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-212777IPR003851Zinc finger, Dof-type
PfamPF027019.4E-332883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2452983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MPSESTDRKL ARAHNPISTY PPPKVTESLP CPRCESTSTK FCYYNNYNLS QPRHFCKSCR  60
RYWTQGGTLR NIPVGGGTRK NSKRTRISSS SSSGAVVATA NSSSCSSAVT HDRVAEPANP  120
VSVLPCGNPE MGLITMTDVN LNDSVGVPGS GSYTTMLNMQ IQGQNFLGLG GFHNHGYGIG  180
SGLEELELGF GTARSWDIPG TGYACTGGGS GAATSGCNTW QMMNGDDQGG NDVGEDCFGW  240
SGLAISTPAG KDLK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4345463e-39AM434546.2 Vitis vinifera contig VV78X101338.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434874.10.0hypothetical protein CICLE_v10002237mg
TrEMBLA0A067H0C60.0A0A067H0C6_CITSI; Uncharacterized protein
STRINGVIT_18s0001g11310.t012e-55(Vitis vinifera)
STRINGPOPTR_0007s11790.13e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94652435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.13e-35Dof family protein